| Attributes | Values |
|---|
| rdf:type
| |
| http://linked.open...gbank/description
| - Teduglutide is a glucagon-like peptide-2 (GLP-2) analogue. It is made up of 33 amino acids and is manufactured using a strain of Escherichia coli modified by recombinant DNA technology. Teduglutide differs from GLP-2 by one amino acid (alanine is substituted by glycine). The significance of this substitution is that teduglutide is longer acting than endogenous GLP-2 as it is more resistant to proteolysis from dipeptidyl peptidase-4. FDA approved on December 21, 2012. (en)
|
| http://linked.open...y/drugbank/dosage
| |
| http://linked.open...generalReferences
| - # Burness CB, McCormack PL: Teduglutide: A Review of its Use in the Treatment of Patients with Short Bowel Syndrome. Drugs. 2013 Jun 1. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/23729002 # Semrad CE: The Long Road to a New Short-Bowel Therapy: Teduglutide for Clinical Use. Clin Gastroenterol Hepatol. 2013 Apr 13. pii: S1542-3565(13)00471-0. doi: 10.1016/j.cgh.2013.03.030. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/23591284 # Jeppesen PB: Teduglutide, a novel glucagon-like peptide 2 analog, in the treatment of patients with short bowel syndrome. Therap Adv Gastroenterol. 2012 May;5(3):159-71. doi: 10.1177/1756283X11436318. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/22570676 (en)
|
| http://linked.open...gy/drugbank/group
| |
| http://linked.open...drugbank/halfLife
| - Terminal half-life, healthy subjects = 2 hours; Terminal half-life, SBS patients = 1.3 hours (en)
|
| http://linked.open...ugbank/indication
| - Treatment of short bowel syndrome (SBS), malabsorption associated with the removal of the intestine, in adults patients who are dependent on parenteral support. (en)
|
| sameAs
| |
| Title
| |
| adms:identifier
| |
| http://linked.open...mechanismOfAction
| - Teduglutide is an analog of naturally occurring human glucagon-like peptide-2 (GLP-2), a peptide secreted by L-cells of the distal intestine in response to meals. GLP-2 increases intestinal and portal blood flow and inhibit gastric acid secretion. Teduglutide binds to the glucagon-like peptide-2 receptors located in enteroendocrine cells, subepithelial myofibroblasts and enteric neurons of the submucosal and myenteric plexus. This causes the release of insulin-like growth factor (IGF)-1, nitric oxide and keratinocyte growth factor (KGF). These growth factors may contribute to the increase in crypt cell growth and surface area of the gastric mucosa. Ultimately, absorption through the intestine is enhanced. (en)
|
| http://linked.open...y/drugbank/patent
| |
| http://linked.open...outeOfElimination
| |
| http://linked.open.../drugbank/synonym
| - (Gly2)glp-2 (en)
- ALX 0600 (en)
- ALX-0600 (en)
- Gattex (en)
- Glucagon-like peptide ii (2-glycine) (human) (en)
- Gly(2)-glp-2 (en)
- HGDGSFSDEMNTILDNLAARDFINWLIQTKITD (en)
- Teduglutide Recombinant (en)
- Teduglutide [rDNA origin] (en)
- His-gly-asp-gly-ser-phe-ser-asp-glu-met-asn-thr-ile-leu-asp-asn-leu-ala-ala-arg-asp-phe-ile-asn-trp-leu-ile-gln-thr-lys-ile-thr-asp (en)
|
| http://linked.open...drugbank/toxicity
| - The most common adverse reactions (≥ 10%) across all studies with GATTEX are abdominal pain, injection site reactions, nausea, headaches, abdominal distension, upper respiratory tract infection. In addition, vomiting and fluid overload were reported in the SBS studies (1 and 3) at rates ≥ 10%. (en)
|
| http://linked.open...umeOfDistribution
| - Vd, healthy subjects = 103 mL/kg (en)
|
| http://linked.open.../drug/hasAHFSCode
| |
| foaf:page
| |
| http://linked.open...Molecular-Formula
| |
| http://linked.open.../Molecular-Weight
| |
| http://linked.open...l/drug/hasATCCode
| |
| http://linked.open...ugbank/absorption
| - The pharmacokinetic profile of teduglutide (when administered subcutaneously) is described by a one-compartment model with first order absorption in the abdomen, arm, and thigh. With escalating doses, teduglutide demonstrates linear pharmacokinetics. Absolute bioavailability, SubQ = 88%; Tmax, SubQ = 3-5 hours; Cmax, 0.05 mg/kg SubQ, SBS patients = 36 ng/mL; AUC, 0.05 mg/kg SubQ, SBS patients = 0.15 µg•hr/mL; Teduglutide does not accumulate following multiple subcutaneous administrations. (en)
|
| http://linked.open.../affectedOrganism
| - Humans and other mammals (en)
|
| http://linked.open...casRegistryNumber
| |
| http://linked.open...rugbank/clearance
| - Plasma clearance, healthy subjects = 123 mL/hr/kg; This value indicates that teduglutide is primarily cleared by the kidney. (en)
|
![[RDF Data]](/fct/images/sw-rdf-blue.png)
![[cxml]](/fct/images/cxml_doc.png)
![[csv]](/fct/images/csv_doc.png)
![[text]](/fct/images/ntriples_doc.png)
![[turtle]](/fct/images/n3turtle_doc.png)
![[ld+json]](/fct/images/jsonld_doc.png)
![[rdf+json]](/fct/images/json_doc.png)
![[rdf+xml]](/fct/images/xml_doc.png)
![[atom+xml]](/fct/images/atom_doc.png)
![[html]](/fct/images/html_doc.png)